PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00222.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 660aa    MW: 71357.3 Da    PI: 6.176
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00222.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.36.8e-13171231262
                              XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                               e k+  r+ +NRe+A+ sRqRKk ++eeLeekv  + +  ++L  ++     e a+l+++
  Rsa1.0_00222.1_g00001.1 171 DEKKKKARLVRNRESAQLSRQRKKHYVEELEEKVRHMHSTITDLNGKIYFFMAENAALRQQ 231
                              678999********************************99999999999888888888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-13169234IPR004827Basic-leucine zipper domain
PfamPF001702.4E-10171231IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.576172232IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.5E-16174232No hitNo description
SuperFamilySSF579591.05E-11174232No hitNo description
CDDcd147046.50E-20175226No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 660 aa     Download sequence    Send to blast
MSQSLTEEPP PSGFDDQFHR PGSDQTPIGE LMSDLGFPID GDFELTFDGM DDLYLPAENE  60
TFLIPEQFGD FTPESESSGD CDCLPKDADK STPLSSQGSG NCGGSDVSDV VVDQKVKVEE  120
DAATATTTTS VTKRKKEEIE EDMSDESRNS KYRRSGEEEV GDASAVTGEE DEKKKKARLV  180
RNRESAQLSR QRKKHYVEEL EEKVRHMHST ITDLNGKIYF FMAENAALRQ QLGGSGMMCP  240
PPPPPPPPMG MYPPMGYQWM PCPPPYMLKQ QGSQVPLVPI PRLKPQSALG SSKGKSKKSE  300
TKTKKVASIS FLGLLFCLFL FGALAPVMNV SYGGISGAFY GNYRSNYVTD QIYSHRRSRV  360
LETSGSGAGS GGFNGNGMHC GRDSNISATE SSVPPGNGSE PLVASLFVPR NDKLVKIDGN  420
LIINSILASE KAVVASRKAS ESNERKADPL ISKDYPPALP LPGVGKIEDM AKHLYRSKAE  480
KQKALSSGSD DTLKEKIKTK AASGEMQQWF REGVAGPMFS SGMCTEVFQF DVSSTSGAII  540
PASPAANVSS EHSNNATDTH MRKNRRTLRG LAIPLPGSDF NFTKEHQRNS SSKEIKPASS  600
MVVSVLVDPR EGGDGGDIDG MIGGPKSLSR VFVVVLVDSA KYVTYSCVLP RSGAPHLVTT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013637012.10.0PREDICTED: bZIP transcription factor 17-like
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLA0A0D3BP020.0A0A0D3BP02_BRAOL; Uncharacterized protein
STRINGscaffold_402899.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein